PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010109885.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 347aa    MW: 39328.5 Da    PI: 10.5563
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010109885.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.22.8e-3192145255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH +Fv+ave+LGG+ekAtPk +l+lm+v gL++ hvkSHLQ+YR+
  XP_010109885.1  92 PRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIGHVKSHLQMYRS 145
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.28288148IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2988146IPR009057Homeodomain-like
SuperFamilySSF466895.02E-1490146IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2292147IPR006447Myb domain, plants
PfamPF002491.6E-893144IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MKKAVLNLGG DTRISESQAE KMMISHLQYS ASKNCSSFDL NEEAAIRSAS TTREKYAGLI  60
ADYGNEMHRN SSSANRKEGK GRVRQYVRSK MPRLRWTPDL HLSFVHAVER LGGQEKATPK  120
LVLQLMNVRG LSIGHVKSHL QMYRSKKLDD AGQLVLFPRY RSKHGRDSQQ HLTLMENSTN  180
ITDQNSNHLN LVHSLVKSAL PRKPLDLKAN IFRSTTSNQV QVPIKRNRFL EQERWPPFET  240
INNTKSVNIG ANITWVNTNS TTTIQSLMNN FGTNGTTLTK FLSRSRSNGY KPNLDRPFQP  300
LQLNPEKVLE EEETVPDLQL GLSQEYKSTS NYKSTQEPST KLSLSLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109885.10.0Putative Myb family transcription factor
TrEMBLW9S3S10.0W9S3S1_9R
STRINGGLYMA05G29161.11e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-38G2-like family protein